PDB entry 1gx1

View 1gx1 on RCSB PDB site
Description: structure of 2c-methyl-d-erythritol-2,4-cyclodiphosphate synthase
Class: synthase
Keywords: synthase, isoprenoid, lyase, isoprene biosynthesis
Deposited on 2002-03-26, released 2002-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.18547
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI, synthetic [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GX1 (0-0)
    • Uniprot P36663 (1-End)
    Domains in SCOPe 2.06: d1gx1a1, d1gx1a2
  • Chain 'B':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI, synthetic [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GX1 (0-0)
    • Uniprot P36663 (1-End)
    Domains in SCOPe 2.06: d1gx1b1, d1gx1b2
  • Chain 'C':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: ESCHERICHIA COLI, synthetic [TaxId:511693]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GX1 (0-0)
    • Uniprot P36663 (1-End)
    Domains in SCOPe 2.06: d1gx1c1, d1gx1c2
  • Heterogens: ZN, CDP, MN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gx1A (A:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gx1A (A:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gx1B (B:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gx1B (B:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gx1C (C:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallikatk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gx1C (C:)
    emrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdigk
    lfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiaed
    lgchmddvnvkattteklgftgrgegiaceavallik