PDB entry 1gwz

View 1gwz on RCSB PDB site
Description: crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
Class: hydrolase
Keywords: hydrolase, protein tyrosine phosphatase, catalytic domain, wpd loop, sh2 domain
Deposited on 1998-08-22, released 1999-08-22
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: shp-1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gwza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gwzA (A:)
    gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
    nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
    pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
    psepggvlsfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdi
    diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqkgqeseygnity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwzA (A:)
    feslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyinanyi
    knqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcvpywpe
    vgmqraygpysvtncgehdtteyklrtlqvspgdlireiwhyqylswpdhgvpsepggvl
    sfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdidiqktiqm
    vraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqk