PDB entry 1gwz

View 1gwz on RCSB PDB site
Description: crystal structure of the catalytic domain of the protein tyrosine phosphatase shp-1
Deposited on 1998-08-22, released 1999-08-22
The last revision prior to the SCOP 1.67 freeze date was dated 1999-08-22, with a file datestamp of 1999-08-21.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.209
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.67: d1gwz__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1gwz_ (-)
    gfweefeslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyi
    nanyiknqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcv
    pywpevgmqraygpysvtncgehdtteyklrtlqvspldngdlireiwhyqylswpdhgv
    psepggvlsfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdi
    diqktiqmvraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqkgqeseygnity
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwz_ (-)
    feslqkqevknlhqrlegqrpenkgknryknilpfdhsrvilqgrdsnipgsdyinanyi
    knqllgpdenaktyiasqgcleatvndfwqmawqensrvivmttrevekgrnkcvpywpe
    vgmqraygpysvtncgehdtteyklrtlqvspgdlireiwhyqylswpdhgvpsepggvl
    sfldqinqrqeslphagpiivhcsagigrtgtiividmlmenistkgldcdidiqktiqm
    vraqrsgmvqteaqykfiyvaiaqfiettkkklevlqsqk