PDB entry 1gwx

View 1gwx on RCSB PDB site
Description: molecular recognition of fatty acids by peroxisome proliferator-activated receptors
Class: transcription
Keywords: ppar, fatty acids, transcription, nuclear receptor fold
Deposited on 1999-03-17, released 2000-03-17
The last revision prior to the SCOP 1.73 freeze date was dated 2000-04-12, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.246
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ppar-delta)
    Species: HOMO SAPIENS
    Gene: PPARD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gwxa_
  • Chain 'B':
    Compound: protein (ppar-delta)
    Species: HOMO SAPIENS
    Gene: PPARD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1gwxb_
  • Heterogens: 433, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gwxA (A:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gwxB (B:)
    qvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwkq
    lvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheai
    famlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlal
    fiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqylfpkllqkmadlrqlv
    tehaqmmqrikktetetslhpllqeiykdmy