PDB entry 1gwt

View 1gwt on RCSB PDB site
Description: recombinant horseradish peroxidase c1a phe221met
Class: oxidoreductase
Keywords: peroxidase, oxidoreductase
Deposited on 2002-03-25, released 2003-03-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.172
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: peroxidase c1a
    Species: ARMORACIA RUSTICANA, synthetic [TaxId:3704]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1GWT (0-0)
      • engineered mutation (221)
    • Uniprot P00433 (1-End)
    Domains in SCOPe 2.06: d1gwta1, d1gwta2
  • Heterogens: HEM, CA, NA, FER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gwtA (A:)
    mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
    sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
    plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
    imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdmdlrtptifdnkyyvnlee
    qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
    ncrvvnsns
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwtA (A:)
    mqltptfydnscpnvsnivrdtivnelrsdpriaasilrlhfhdcfvngcdasilldntt
    sfrtekdafgnansargfpvidrmkaavesacprtvscadlltiaaqqsvtlaggpswrv
    plgrrdslqafldlananlpapfftlpqlkdsfrnvglnrssdlvalsgghtfgknqcrf
    imdrlynfsntglpdptlnttylqtlrglcplngnlsalvdmdlrtptifdnkyyvnlee
    qkgliqsdqelfsspnatdtiplvrsfanstqtffnafveamdrmgnitpltgtqgqirl
    ncrvvnsn