PDB entry 1gws

View 1gws on RCSB PDB site
Description: hexadecaheme high molecular weight cytochrome hmc from desulfovibrio vulgaris hildenborough
Class: electron transport
Keywords: electron transport, multiheme cytochrome, sulfate reducing bacteria, periplasmic, heme
Deposited on 2002-03-25, released 2003-02-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 2.42 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: high-molecular-weight cytochrome c
    Species: DESULFOVIBRIO VULGARIS [TaxId:882]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gwsa_
  • Heterogens: HEC, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gwsA (A:)
    mrngrtllrwagvlaataiigvggfwsqgttkalpegpgekradlieigamerfgkldlp
    kvafrhdqhttavtgmgkdcaachkskdgkmslkfmrlddnsaaelkeiyhancigchtd
    lakagkktgpqdgecrschnpkpsaasswkeigfdkslhyrhvaskaikpvgdpqkncga
    chhvydeaskklvwgknkedscrachgekpvdkrpaldtaahtacischmdvaktkaetg
    pvncagchapeaqakfkvvrevprldrgqpdaalilpvpgkdapremkgtmkpvafdhka
    heakandcrtchhvridtctachtvngtadskfvqlekamhqpdsmrscvgchntrvqqp
    tcagchgfikptksdaqcgvchvaapgfdakqveagallnlkaeqrsqvaasmlsarpqp
    kgtfdlndipekvvigsiakeyqpsefphrkivktliagigedklaatfhiekgtlcqgc
    hhnspasltppkcaschgkpfdadrgdrpglkaayhqqcmgchdrmkiekpantacvdch
    kerak
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwsA (A:)
    kradlieigamerfgkldlpkvafrhdqhttavtgmgkdcaachkskdgkmslkfmrldd
    nsaaelkeiyhancigchtdlakagkktgpqdgecrschnpkpsaasswkeigfdkslhy
    rhvaskaikpvgdpqkncgachhvydeaskklvwgknkedscrachgekpvdkrpaldta
    ahtacischmdvaktkaetgpvncagchapeaqakfkvvrevprldrgqpdaalilpvpg
    kdapremkgtmkpvafdhkaheakandcrtchhvridtctachtvngtadskfvqlekam
    hqpdsmrscvgchntrvqqptcagchgfikptksdaqcgvchvaapgfdakqveagalln
    lkaeqrsqvaasmlsarpqpkgtfdlndipekvvigsiakeyqpsefphrkivktliagi
    gedklaatfhiekgtlcqgchhnspasltppkcaschgkpfdadrgdrpglkaayhqqcm
    gchdrmkiekpantacvdchker