PDB entry 1gwr

View 1gwr on RCSB PDB site
Description: human oestrogen receptor alpha ligand-binding domain in complex with 17beta-oestradiol and tif2 nrbox3 peptide
Class: nuclear receptor
Keywords: nuclear receptor, transcription factor, transactivation, agonist, af2 coactivator, receptor, activator, transcripti regulation, DNA-binding, nuclear protein, zinc finger, ster binding, phosphorylation, polymorphism, alternative splicing
Deposited on 2002-03-22, released 2002-08-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.225
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: oestrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gwra_
  • Chain 'B':
    Compound: oestrogen receptor
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gwrb_
  • Chain 'C':
    Compound: transcription intermediary factor-2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: transcription intermediary factor-2
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
  • Heterogens: EST, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gwrA (A:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwrA (A:)
    lalsltadqmvsalldaeppilyseyrpfseasmmglltnladrelvhminwakrvpgfv
    dltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifdml
    latssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihlma
    kagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahrl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gwrB (B:)
    slalsltadqmvsalldaeppilyseydptrpfseasmmglltnladrelvhminwakrv
    pgfvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmvei
    fdmllatssrfrmmnlqgeefvclksiillnsgvytflsstlksleekdhihrvldkitd
    tlihlmakagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydllleml
    dahrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gwrB (B:)
    slalsltadqmvsalldaeppilyseydppfseasmmglltnladrelvhminwakrvpg
    fvdltlhdqvhllecawleilmiglvwrsmehpgkllfapnllldrnqgkcvegmveifd
    mllatssrfrmmnlqgeefvclksiillnsgvytftlksleekdhihrvldkitdtlihl
    makagltlqqqhqrlaqlllilshirhmsnkgmehlysmkcknvvplydlllemldahr
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.