PDB entry 1gw6

View 1gw6 on RCSB PDB site
Description: structure of leukotriene a4 hydrolase d375n mutant
Class: hydrolase
Keywords: hydrolase, mutagenesis studies, alpha-beta protein
Deposited on 2002-03-07, released 2003-03-06
The last revision prior to the SCOP 1.75 freeze date was dated 2003-03-06, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Leukotriene A-4 hydrolase
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09960 (0-609)
      • engineered mutation (374)
    Domains in SCOP 1.75: d1gw6a1, d1gw6a2, d1gw6a3
  • Heterogens: ACT, YB, ZN, BES, IMD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gw6A (A:)
    peivdtcslaspasvcrtkhlhlrcsvdftrrtltgtaaltvqsqednlrslvldtkdlt
    iekvvingqevkyalgerqsykgspmeislpialsknqeivieisfetspkssalqwltp
    eqtsgkehpylfsqcqaihcrailpcqdtpsvkltytaevsvpkelvalmsairdgetpd
    pedpsrkiykfiqkvpipcylialvvgalesrqigprtlvwsekeqveksayefsetesm
    lkiaedlggpyvwgqydllvlppsfpyggmenpcltfvtptllagdkslsnviaheishs
    wtgnlvtnktwdhfwlneghtvylerhicgrlfgekfrhfnalggwgelqnsvktfgeth
    pftklvvdltdidpnvayssvpyekgfallfyleqllggpeiflgflkayvekfsyksit
    tddwkdflysyfkdkvdvlnqvdwnawlyspglppikpnydmtltnacialsqrwitake
    ddlnsfnatdlkdlsshqlneflaqtlqraplplghikrmqevynfnainnseirfrwlr
    lciqskwedaiplalkmateqgrmkftrplfkdlaafdkshdqavrtyqehkasmhpvta
    mlvgkdlkvd