PDB entry 1gw0

View 1gw0 on RCSB PDB site
Description: crystal structure of laccase from melanocarpus albomyces in four copper form
Deposited on 2002-03-01, released 2002-07-31
The last revision prior to the SCOP 1.61 freeze date was dated 2002-07-31, with a file datestamp of 2002-07-31.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.189
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gw0A (A:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gw0B (B:)
    eptcntpsnracwsdgfdintdyevstpdtgvtqsyvfnltevdnwmgpdgvvkekvmli
    ngnimgpnivanwgdtvevtvinnlvtngtsihwhgihqkdtnlhdgangvtecpippkg
    gqrtyrwrarqygtswyhshfsaqygngvvgtiqingpaslpydidlgvfpitdyyyraa
    ddlvhftqnnappfsdnvlingtavnpntgegqyanvtltpgkrhrlrilntstenhfqv
    slvnhtmtviaadmvpvnamtvdslflavgqrydvvidasrapdnywfnvtfggqaacgg
    slnphpaaifhyagapgglptdegtppvdhqcldtldvrpvvprsvpvnsfvkrpdntlp
    valdltgtplfvwkvngsdinvdwgkpiidyiltgntsypvsdnivqvdavdqwtywlie
    ndpegpfslphpmhlhghdflvlgrspdvpaasqqrfvfdpavdlarlngdnpprrdttm
    lpaggwlllafrtdnpgawlfhchiawhvsgglsvdflerpadlrqrisqededdfnrvc
    dewraywptnpypkidsgl