PDB entry 1gvs

View 1gvs on RCSB PDB site
Description: Structure of pentaerythritol tetranitrate reductase and complexed with picric acid
Class: oxidoreductase
Keywords: flavoenzyme, explosive degradation, steroid binding, oxidoreductase
Deposited on 2002-02-27, released 2003-02-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-29, with a file datestamp of 2017-03-24.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: N/A
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gvsa_
  • Heterogens: FMN, TNF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gvsA (A:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gvsA (A:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
    sl