PDB entry 1gvp

View 1gvp on RCSB PDB site
Description: gene v protein (single-stranded DNA binding protein)
Class: DNA-binding protein
Keywords: DNA-binding protein, DNA replication
Deposited on 1997-02-26, released 1997-09-04
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.209
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: gene v protein
    Species: Escherichia coli [TaxId:562]
    Gene: GEN V IN BACTERIOPHAGE F1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gvpa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gvpA (A:)
    mikveikpsqaqfttrsgvsrqgkpyslneqlcyvdlgneypvlvkitldegqpayapgl
    ytvhlssfkvgqfgslmidrlrlvpak