PDB entry 1gvo

View 1gvo on RCSB PDB site
Description: structure of pentaerythritol tetranitrate reductase and complexed with 2,4 dinitrophenol
Class: oxidoreductase
Keywords: flavoenzyme, explosive degradation, steroid binding, oxidoreductase
Deposited on 2002-02-22, released 2003-02-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 1.38 Å
R-factor: 0.175
AEROSPACI score: 0.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pentaerythritol tetranitrate reductase
    Species: Enterobacter cloacae [TaxId:550]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gvoa_
  • Heterogens: FMN, DNF, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gvoA (A:)
    saeklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatq
    isaqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapv
    sasalnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvel
    hsahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtf
    qnvdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviiga
    gaytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytd
    ypsl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gvoA (A:)
    eklftplkvgavtapnrvfmapltrlrsiepgdiptplmgeyyrqrasagliiseatqis
    aqakgyagapglhspeqiaawkkitagvhaedgriavqlwhtgrishssiqpggqapvsa
    salnantrtslrdengnairvdtttpraleldeipgivndfrqavanareagfdlvelhs
    ahgyllhqflspssnqrtdqyggsvenrarlvlevvdavcnewsadrigirvspigtfqn
    vdngpneeadalylieelakrgiaylhmsetdlaggkpyseafrqkvrerfhgviigaga
    ytaekaedligkglidavafgrdyianpdlvarlqkkaelnpqrpesfygggaegytdyp
    sl