PDB entry 1gvi

View 1gvi on RCSB PDB site
Description: thermus maltogenic amylase in complex with beta-cd
Class: hydrolase
Keywords: amylase, transglycosylation, beta-cyclodextrin, hydrolase
Deposited on 2002-02-14, released 2002-06-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.192
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: maltogenic amylase
    Species: THERMUS SP. [TaxId:275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69007 (0-587)
      • conflict (356)
    Domains in SCOPe 2.07: d1gvia1, d1gvia2, d1gvia3
  • Chain 'B':
    Compound: maltogenic amylase
    Species: THERMUS SP. [TaxId:275]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O69007 (0-587)
      • conflict (356)
    Domains in SCOPe 2.07: d1gvib1, d1gvib2, d1gvib3
  • Heterogens: BCD

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gviA (A:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgliwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gviB (B:)
    mrkeaihhrstdnfayaydsetlhlrlqtkkndvdhvellfgdpyewhdgawqfqtmpmr
    ktgsdglfdywlaevkppyrrlrygfvlraggeklvytekgfyheapsddtayyfcfpfl
    hrvdlfqapdwvkdtvwyqifperfangnpaispkgarpwgsedptptsffggdlqgiid
    hldyladlgitgiyltpifrapsnhkydtadyfeidphfgdketlktlvkrchekgirvm
    ldavfnhcgyefapfqdvlkngaasrykdwfhirefplqteprpnydtfafvphmpklnt
    ahpevkrylldvatywirefdidgwrldvaneidhqfwrefrqavkalkpdvyilgliwh
    dampwlrgdqfdavmnypladaalrffakedmsasefadrlmhvlhsypkqvneaafnll
    gshdtprlltvcggdvrkvkllflfqltftgspciyygdeigmtggndpecrkcmvwdpe
    kqnkelyehvkqlialrkqyralrrgdvafltaddevnhlvyaktdgnetvmiiinrsne
    aaeipmpidargkwlvnlltgerfaaeaetlcvslppygfvlyavesw