PDB entry 1gvf

View 1gvf on RCSB PDB site
Description: structure of tagatose-1,6-bisphosphate aldolase
Class: lyase
Keywords: lyase, zinc.
Deposited on 2002-02-11, released 2002-06-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.1268
AEROSPACI score: 0.71 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: tagatose-bisphosphate aldolase agay
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gvfa_
  • Chain 'B':
    Compound: tagatose-bisphosphate aldolase agay
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1gvfb_
  • Heterogens: PGH, ZN, NA, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gvfA (A:)
    msiistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhiale
    eiyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksv
    vdfchsqdcsveaelgrlggveddmsvdaesafltdpqeakrfveltgvdslavaigtah
    glysktpkidfqrlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafa
    gavkawfaenpqgndpryymrvgmdamkevvrnkinvcgsanrisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gvfA (A:)
    siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee
    iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv
    dfchsqdcsveaelgrlgsafltdpqeakrfveltgvdslavaigtahglysktpkidfq
    rlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafagavkawfaenpq
    gndpryymrvgmdamkevvrnkinvcgsanris
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gvfB (B:)
    msiistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhiale
    eiyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksv
    vdfchsqdcsveaelgrlggveddmsvdaesafltdpqeakrfveltgvdslavaigtah
    glysktpkidfqrlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafa
    gavkawfaenpqgndpryymrvgmdamkevvrnkinvcgsanrisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gvfB (B:)
    siistkyllqdaqangyavpafnihnaetiqailevcsemrspvilagtpgtfkhialee
    iyalcsaysttynmplalhldhheslddirrkvhagvrsamidgshfpfaenvklvksvv
    dfchsqdcsveaelgrlggvesafltdpqeakrfveltgvdslavaigtahglysktpki
    dfqrlaeirevvdvplvlhgasdvpdefvrrtielgvtkvnvatelkiafagavkawfae
    npqgndpryymrvgmdamkevvrnkinvcgsanri