PDB entry 1gvd

View 1gvd on RCSB PDB site
Description: crystal structure of c-myb r2 v103l mutant
Deposited on 2002-02-08, released 2003-07-03
The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-03, with a file datestamp of 2003-07-03.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.18
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1gvda_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gvdA (A:)
    likgpwtkeedqrliklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe