PDB entry 1gvc

View 1gvc on RCSB PDB site
Description: 18kDa N-II domain fragment of duck ovotransferrin + NTA
Class: iron transport
Keywords: iron transport, glycoprotein, metal-binding
Deposited on 2002-02-07, released 2002-02-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-05-08, with a file datestamp of 2019-05-03.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: ANAS PLATYRHYNCHOS [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56410 (0-156)
      • see remark 999 (45)
      • see remark 999 (56-57)
      • see remark 999 (75)
    Domains in SCOPe 2.08: d1gvca_
  • Heterogens: CO3, NTA, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gvcA (A:)
    syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrgdiewegiesgsveq
    avakffsascvpgatteqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
    ttvqenapeekdeyellcldgtrqpvdsyktcnwarv