PDB entry 1gv9

View 1gv9 on RCSB PDB site
Description: p58/ergic-53
Deposited on 2002-02-07, released 2002-02-28
The last revision prior to the SCOP 1.61 freeze date was dated 2002-02-28, with a file datestamp of 2002-02-28.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: 0.19175
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d1gv9a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gv9A (A:)
    phrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiriapslksqrgsvwtktkaaf
    enwevevtfrvtgrgrigadglaiwytenqgldgpvfgsadmwngvgiffdsfdndgkkn
    npaivvvgnngqinydhqndgatqalascqrdfrnkpypvrakityyqktltvminngft
    pdkndyefcakvenmviptqghfgisaatggladdhdvlsfltfqlte
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv9A (A:)
    phrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiriapslksqrgsvwtktkaaf
    enwevevtfrvtgrgrigadglaiwytenqgldgpvfgsadmwngvgiffdsfdnnpaiv
    vvgnngqinydhqndgatqalascqrdfrnkpypvrakityyqktltvminngftpdknd
    yefcakvenmviptqghfgisaatggladdhdvlsfltfqlte