PDB entry 1gv9

View 1gv9 on RCSB PDB site
Description: p58/ERGIC-53
Class: carbohydrate binding
Keywords: lectin, carbohydrate binding
Deposited on 2002-02-07, released 2002-02-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-17, with a file datestamp of 2018-01-12.
Experiment type: XRAY
Resolution: 1.46 Å
R-factor: N/A
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: p58/ergic-53
    Species: Rattus norvegicus [TaxId:10116]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gv9a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gv9A (A:)
    sqfvgsdgmggdaaapgaagtqaelphrrfeykysfkgphlvqsdgtvpfwahagnaips
    adqiriapslksqrgsvwtktkaafenwevevtfrvtgrgrigadglaiwytenqgldgp
    vfgsadmwngvgiffdsfdndgkknnpaivvvgnngqinydhqndgatqalascqrdfrn
    kpypvrakityyqktltvminngftpdkndyefcakvenmviptqghfgisaatggladd
    hdvlsfltfqltepgkeppt
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv9A (A:)
    phrrfeykysfkgphlvqsdgtvpfwahagnaipsadqiriapslksqrgsvwtktkaaf
    enwevevtfrvtgrgrigadglaiwytenqgldgpvfgsadmwngvgiffdsfdnnpaiv
    vvgnngqinydhqndgatqalascqrdfrnkpypvrakityyqktltvminngftpdknd
    yefcakvenmviptqghfgisaatggladdhdvlsfltfqlte