PDB entry 1gv8

View 1gv8 on RCSB PDB site
Description: 18 kda fragment of n-II domain of duck ovotransferrin
Class: iron transport
Keywords: iron transport, glycoprotein, metal-binding
Deposited on 2002-02-07, released 2002-02-12
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.171
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ovotransferrin
    Species: ANAS PLATYRHYNCHOS [TaxId:8839]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56410 (0-158)
      • conflict (45)
      • conflict (56-57)
      • conflict (75)
    Domains in SCOPe 2.06: d1gv8a_
  • Heterogens: GLY, CO3, FE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gv8A (A:)
    syyavavvkkgtdfmikdlrgktschtglgrsagwnipigtlihrgdiewegiesgsveq
    avakffsascvpgatteqklcrqckgdaktkclrnapysgysgafqclkdgkgdvafvkh
    ttvqenapeekdeyellcldgtrqpvdsyktcnwarvaa