PDB entry 1gv7

View 1gv7 on RCSB PDB site
Description: ARH-I, an angiogenin/RNase A chimera
Class: hydrolase
Keywords: hydrolase, pancreatic ribonuclease, angiogenesis, angiogenin, chimera, hybrid, homolog scanning mutagenesis
Deposited on 2002-02-06, released 2002-08-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-03-15, with a file datestamp of 2017-03-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: -1.72 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: angiogenin
    Species: HOMO SAPIENS, synthetic [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gv7a_
  • Heterogens: CIT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gv7A (A:)
    ednsrythfltqhydakpqgrddrycesimrrrgltspckdintfihgnkrsikaicsqk
    nvackngqtncyiskssfqvttcklhggspwppcqyratagfrnvvvacenglpvhldqs
    ifr