PDB entry 1gv5

View 1gv5 on RCSB PDB site
Description: crystal structure of c-myb r2
Deposited on 2002-02-06, released 2003-07-03
The last revision prior to the SCOP 1.69 freeze date was dated 2003-07-03, with a file datestamp of 2003-07-03.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.178
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1gv5a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gv5A (A:)
    likgpwtkeedqrviklvqkygpkrwsviakhlkgrigkqcrerwhnhlnpe