PDB entry 1gv4

View 1gv4 on RCSB PDB site
Description: murine apoptosis-inducing factor (aif)
Deposited on 2002-02-05, released 2002-04-26
The last revision prior to the SCOP 1.69 freeze date was dated 2002-05-31, with a file datestamp of 2002-05-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.21836
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gv4A (A:)
    mhhhhhhssglvprggsgmketaaakferqhmdspdlgtvpqirapshvpflligggtaa
    faaarsirardpgarvlivsedpelpymrpplskelwfsddpnvtktlqfrqwngkersi
    yfqppsfyvsaqdlpnienggvavltgkkvvhldvrgnmvklndgsqitfekcliatggt
    prslsaidragaevksrttlfrkigdfralekisrevksitvigggflgselacalgrks
    qasgieviqlfpekgnmgkilpqylsnwtmekvkregvkvmpnaivqsvgvsggrllikl
    kdgrkvetdhivtavglepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfy
    diklgrrrvehhdhavvsgrlagenmtgaakpywhqsmfwsdlgpdvgyeaiglvdsslp
    tvgvfakataqdnpksateqsgtgirseseteseaseitippsapavpqvpvegedygkg
    vifylrdkvvvgivlwnvfnrmpiarkiikdgeqhedlnevaklfnih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv4A (A:)
    tvpqirapshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwf
    sddpnvtktlqfrqwngkersiyfqppsfyvsaqdlpnienggvavltgkkvvhldvrgn
    mvklndgsqitfekcliatggtprslsaidragaevksrttlfrkigdfralekisrevk
    sitvigggflgselacalgrksqasgieviqlfpekgnmgkilpqylsnwtmekvkregv
    kvmpnaivqsvgvsggrlliklkdgrkvetdhivtavglepnvelaktggleidsdfggf
    rvnaelqarsniwvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywhqsm
    fwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirseseteseasei
    tippsapavpqvpvegedygkgvifylrdkvvvgivlwnvfnrmpiarkiikdgeqhedl
    nevaklfnih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gv4B (B:)
    mhhhhhhssglvprggsgmketaaakferqhmdspdlgtvpqirapshvpflligggtaa
    faaarsirardpgarvlivsedpelpymrpplskelwfsddpnvtktlqfrqwngkersi
    yfqppsfyvsaqdlpnienggvavltgkkvvhldvrgnmvklndgsqitfekcliatggt
    prslsaidragaevksrttlfrkigdfralekisrevksitvigggflgselacalgrks
    qasgieviqlfpekgnmgkilpqylsnwtmekvkregvkvmpnaivqsvgvsggrllikl
    kdgrkvetdhivtavglepnvelaktggleidsdfggfrvnaelqarsniwvagdaacfy
    diklgrrrvehhdhavvsgrlagenmtgaakpywhqsmfwsdlgpdvgyeaiglvdsslp
    tvgvfakataqdnpksateqsgtgirseseteseaseitippsapavpqvpvegedygkg
    vifylrdkvvvgivlwnvfnrmpiarkiikdgeqhedlnevaklfnih
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv4B (B:)
    tvpqirapshvpflligggtaafaaarsirardpgarvlivsedpelpymrpplskelwf
    sddpnvtktlqfrqwngkersiyfqppsfyvsaqdlpnienggvavltgkkvvhldvrgn
    mvklndgsqitfekcliatggtprslsaidragaevksrttlfrkigdfralekisrevk
    sitvigggflgselacalgrksqasgieviqlfpekgnmgkilpqylsnwtmekvkregv
    kvmpnaivqsvgvsggrlliklkdgrkvetdhivtavglepnvelaktggleidsdfggf
    rvnaelqarsniwvagdaacfydiklgrrrvehhdhavvsgrlagenmtgaakpywhqsm
    fwsdlgpdvgyeaiglvdsslptvgvfakataqdnpksateqsgtgirseseteseasei
    tippsapavpqvpvegedygkgvifylrdkvvvgivlwnvfnrmpiarkiikdgeqhedl
    nevaklfnih