PDB entry 1gv3

View 1gv3 on RCSB PDB site
Description: the 2.0 angstrom resolution structure of the catalytic portion of a cyanobacterial membrane-bound manganese superoxide dismutase
Class: manganese superoxide dismutase
Keywords: manganese superoxide dismutase, anabaena pcc 7120, crystal structure
Deposited on 2002-02-05, released 2002-08-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.188
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: manganese superoxide dismutase
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GV3
      • conflict (178)
      • conflict (186)
    • Uniprot Q8Z0M1
    Domains in SCOPe 2.06: d1gv3a1, d1gv3a2
  • Chain 'B':
    Compound: manganese superoxide dismutase
    Species: ANABAENA SP. [TaxId:103690]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GV3
      • conflict (178)
      • conflict (186)
    • Uniprot Q8Z0M1
    Domains in SCOPe 2.06: d1gv3b1, d1gv3b2
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gv3A (A:)
    maanslptnvaspvqtttpttdkrsigfidrqlgtnpaelpplpygydalekaidaetmk
    lhhdkhhaayvnnlnnalkkhpelqnssveallrdlnsvpedirttvrnnggghlnhtif
    wqimspdgggqptgdiaqeinqtfgsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvv
    stpnqdnpimegsypimgndvwehayylryqnrrpeylnnwwnvvnwseinrrtqasrqs
    nshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv3A (A:)
    sigfidrqlgtnpaelpplpygydalekaidaetmklhhdkhhaayvnnlnnalkkhpel
    qnssveallrdlnsvpedirttvrnnggghlnhtifwqimspdgggqptgdiaqeinqtf
    gsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvvstpnqdnpimegsypimgndvweh
    ayylryqnrrpeylnnwwnvvnwseinrrtqasr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gv3B (B:)
    maanslptnvaspvqtttpttdkrsigfidrqlgtnpaelpplpygydalekaidaetmk
    lhhdkhhaayvnnlnnalkkhpelqnssveallrdlnsvpedirttvrnnggghlnhtif
    wqimspdgggqptgdiaqeinqtfgsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvv
    stpnqdnpimegsypimgndvwehayylryqnrrpeylnnwwnvvnwseinrrtqasrqs
    nshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv3B (B:)
    sigfidrqlgtnpaelpplpygydalekaidaetmklhhdkhhaayvnnlnnalkkhpel
    qnssveallrdlnsvpedirttvrnnggghlnhtifwqimspdgggqptgdiaqeinqtf
    gsfeefkkqfnqaggdrfgsgwvwlvrnpqgqlqvvstpnqdnpimegsypimgndvweh
    ayylryqnrrpeylnnwwnvvnwseinrrtqasr