PDB entry 1gv1

View 1gv1 on RCSB PDB site
Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
Class: oxidoreductase
Keywords: dehydrogenase, oxidoreductase, tricarboxylic acid cycle, nad
Deposited on 2002-02-04, released 2002-02-20
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME [TaxId:1098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-End)
      • conflict (226)
      • conflict (228)
    Domains in SCOPe 2.04: d1gv1a1, d1gv1a2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME [TaxId:1098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-End)
      • conflict (226)
      • conflict (228)
    Domains in SCOPe 2.04: d1gv1b1, d1gv1b2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME [TaxId:1098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-End)
      • conflict (226)
      • conflict (228)
    Domains in SCOPe 2.04: d1gv1c1, d1gv1c2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME [TaxId:1098]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-End)
      • conflict (226)
      • conflict (228)
    Domains in SCOPe 2.04: d1gv1d1, d1gv1d2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gv1A (A:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv1A (A:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gv1B (B:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv1B (B:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitagldllmknagivkevtdnimkhsknpiiivvsnpldimthvaw
    vrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvag
    ipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpc
    avglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gv1C (C:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv1C (C:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gv1D (D:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gv1D (D:)
    mkitvigagnvgattafriadkklarelvlldvvegipqgkgldmyetgpvglfdtkitg
    sndyadtadsdiviitaglllmknagivkevtdnimkhsknpiiivvsnpldimthvawv
    rsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvagi
    pisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpca
    vglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivdenc