PDB entry 1guz

View 1guz on RCSB PDB site
Description: structural basis for thermophilic protein stability: structures of thermophilic and mesophilic malate dehydrogenases
Class: oxidoreductase
Keywords: dehydrogenase, oxidoreductase, tricarboxylic acid cycle, nad
Deposited on 2002-02-04, released 2002-02-21
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.243
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME, CHLOROBIUM TEPIDUM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-70)
      • conflict (226)
      • conflict (228)
    • Uniprot P80038 (71-End)
    Domains in SCOPe 2.04: d1guza1, d1guza2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME, CHLOROBIUM TEPIDUM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-70)
      • conflict (226)
      • conflict (228)
    • Uniprot P80038 (71-End)
    Domains in SCOPe 2.04: d1guzb1, d1guzb2
  • Chain 'C':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME, CHLOROBIUM TEPIDUM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-70)
      • conflict (226)
      • conflict (228)
    • Uniprot P80038 (71-End)
    Domains in SCOPe 2.04: d1guzc1, d1guzc2
  • Chain 'D':
    Compound: malate dehydrogenase
    Species: CHLOROBIUM VIBRIOFORME, CHLOROBIUM TEPIDUM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80039 (0-70)
      • conflict (226)
      • conflict (228)
    • Uniprot P80038 (71-End)
    Domains in SCOPe 2.04: d1guzd1, d1guzd2
  • Heterogens: NAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1guzA (A:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guzA (A:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1guzB (B:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guzB (B:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitagldllmknagivkevtdnimkhsknpiiivvsnpldimthvaw
    vrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvag
    ipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpc
    avglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivdenckml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1guzC (C:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guzC (C:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1guzD (D:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitaglprkpgmtredllmknagivkevtdnimkhsknpiiivvsnp
    ldimthvawvrsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvp
    vvkyttvagipisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesiv
    ldrkrvlpcavglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivde
    nckmlestig
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guzD (D:)
    mkitvigagnvgattafrlaekqlarelvlldvvegipqgkaldmyesgpvglfdtkvtg
    sndyadtansdiviitaglllmknagivkevtdnimkhsknpiiivvsnpldimthvawv
    rsglpkervigmagvldaarfrsfiamelgvsmqdinacvlgghgdamvpvvkyttvagi
    pisdllpaetidklvertrnggaeivehlkqgsafyapassvvemvesivldrkrvlpca
    vglegqygidktfvgvpvklgrngveqiyeinldqadldllqksakivdenckml