PDB entry 1gux

View 1gux on RCSB PDB site
Description: rb pocket bound to e7 lxcxe motif
Deposited on 1997-11-15, released 1998-12-02
The last revision prior to the SCOP 1.71 freeze date was dated 1999-01-13, with a file datestamp of 1999-01-20.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.218
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1guxa_
  • Chain 'B':
    Domains in SCOP 1.71: d1guxb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1guxA (A:)
    htpvrtvmntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfa
    kavgqgcveigsqryklgvrlyyrvmesmlkseeerlsiqnfskllndnifhmsllacal
    evvmatysrstsqnldsgtdlsfpwilnvlnlkafdfykviesfikaegnltremikhle
    rcehrimeslawlsdsplfdlikqskdregptdhlesa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guxA (A:)
    ntiqqlmmilnsasdqpsenlisyfnnctvnpkesilkrvkdigyifkekfakavgqgcv
    eigsqryklgvrlyyrvmesmlksenfskllndnifhmsllacalevvmatysfpwilnv
    lnlkafdfykviesfikaegnltremikhlercehrimeslawlsdsplfdlikqsk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1guxB (B:)
    fqtqkplkstslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelm
    rdrhldqimmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivf
    ynsvfmqrlktnilqyastrpptlspiphipr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1guxB (B:)
    tslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqim
    mcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqrl
    ktnilqyastrpptlspiphi