PDB entry 1guw

View 1guw on RCSB PDB site
Description: structure of the chromodomain from mouse hp1beta in complex with the lysine 9-methyl histone h3 n-terminal peptide, nmr, 25 structures
Class: chromatin-binding
Keywords: chromatin-binding, lysine methylation, heterochromatin, histone modification
Deposited on 2002-02-01, released 2002-03-12
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromobox protein homolog 1
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUW (9-10)
    • Uniprot P23197 (2-72)
    Domains in SCOPe 2.05: d1guwa_
  • Chain 'B':
    Compound: Histone H3.1
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1guwA (A:)
    hmveevleeeeeeyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaef
    lqsqktahetdks
    

  • Chain 'B':
    No sequence available.