PDB entry 1gup

View 1gup on RCSB PDB site
Description: structure of nucleotidyltransferase complexed with udp-galactose
Class: nucleotidyltransferase
Keywords: transferase, nucleotidyltransferase, galactose metabolism
Deposited on 1996-10-23, released 1997-11-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.191
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galactose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09148 (Start-347)
      • engineered (165)
    Domains in SCOPe 2.07: d1gupa1, d1gupa2
  • Chain 'B':
    Compound: galactose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09148
      • engineered (165)
    Domains in SCOPe 2.07: d1gupb1, d1gupb2
  • Chain 'C':
    Compound: galactose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09148
      • engineered (165)
    Domains in SCOPe 2.07: d1gupc1, d1gupc2
  • Chain 'D':
    Compound: galactose-1-phosphate uridylyltransferase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09148
      • engineered (165)
    Domains in SCOPe 2.07: d1gupd1, d1gupd2
  • Heterogens: GDU, ZN, FE, K, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gupA (A:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gupA (A:)
    tqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvrv
    tgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpe
    lsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneaer
    edrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahv
    lritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyp
    pllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gupB (B:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gupB (B:)
    tqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvrv
    tgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpe
    lsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneaer
    edrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahv
    lritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyp
    pllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfre
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gupC (C:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gupC (C:)
    tqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvrv
    tgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpe
    lsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneaer
    edrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahv
    lritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyp
    pllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfre
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gupD (D:)
    mtqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvr
    vtgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlp
    elsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneae
    redrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkah
    vlritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfy
    ppllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfresgv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gupD (D:)
    tqfnpvdhphrrynpltgqwilvsphrakrpwqgaqetpakqvlpahdpdcflcagnvrv
    tgdknpdytgtyvftndfaalmsdtpdapeshdplmrcqsargtsrvicfspdhsktlpe
    lsvaalteivktwqeqtaelgktypwvqvfenkgaamgcsnphpggqiwansflpneaer
    edrlqkeyfaeqkspmlvdyvqreladgsrtvvetehwlavvpywaawpfetlllpkahv
    lritdltdaqrsdlalalkkltsrydnlfqcsfpysmgwhgapfngeenqhwqlhahfyp
    pllrsatvrkfmvgyemlaetqrdltaeqaaerlravsdihfre