PDB entry 1gum

View 1gum on RCSB PDB site
Description: human glutathione transferase a4-4 without ligands
Class: transferase
Keywords: glutathione transferase, oxidative stress, alkenal degradation
Deposited on 1998-06-11, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.255
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1guma1, d1guma2
  • Chain 'B':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gumb1, d1gumb2
  • Chain 'C':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gumc1, d1gumc2
  • Chain 'D':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gumd1, d1gumd2
  • Chain 'E':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gume1, d1gume2
  • Chain 'F':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gumf1, d1gumf2
  • Chain 'G':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gumg1, d1gumg2
  • Chain 'H':
    Compound: protein (glutathione transferase a4-4)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gumh1, d1gumh2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gumA (A:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumA (A:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gumB (B:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumB (B:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gumC (C:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumC (C:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gumD (D:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumD (D:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gumE (E:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumE (E:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gumF (F:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumF (F:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gumG (G:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumG (G:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gumH (H:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gumH (H:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif