PDB entry 1gul

View 1gul on RCSB PDB site
Description: human glutathione transferase a4-4 complex with iodobenzyl glutathione
Class: transferase/transferase inhibitor
Keywords: oxidative stress, alkenal degradation, transferase-transferase inhibitor complex
Deposited on 1998-06-10, released 1999-01-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.25
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gula1, d1gula2
  • Chain 'B':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gulb1, d1gulb2
  • Chain 'C':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gulc1, d1gulc2
  • Chain 'D':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1guld1, d1guld2
  • Chain 'E':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gule1, d1gule2
  • Chain 'F':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gulf1, d1gulf2
  • Chain 'G':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gulg1, d1gulg2
  • Chain 'H':
    Compound: glutathione transferase a4-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gulh1, d1gulh2
  • Chain 'I':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Chain 'J':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Chain 'K':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Chain 'L':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Chain 'M':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Chain 'N':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Chain 'O':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Chain 'P':
    Compound: S-(2-iodobenzyl) glutathione
    Database cross-references and differences (RAF-indexed):
    • PDB 1GUL (0-2)
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gulA (A:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulA (A:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gulB (B:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulB (B:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gulC (C:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulC (C:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gulD (D:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulD (D:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gulE (E:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulE (E:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gulF (F:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulF (F:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gulG (G:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulG (G:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gulH (H:)
    maarpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmvei
    dgmklvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqke
    vvnmaqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpf
    lqeytvklsniptikrflepgskkkpppdeiyvrtvynifrp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gulH (H:)
    rpklhypngrgrmesvrwvlaaagvefdeefletkeqlyklqdgnhllfqqvpmveidgm
    klvqtrsilhyiadkhnlfgknlkertlidmyvegtldllellimhpflkpddqqkevvn
    maqkaiiryfpvfekilrghgqsflvgnqlsladvillqtilaleekipnilsafpflqe
    ytvklsniptikrflepgskkkpppdeiyvrtvynif
    

  • Chain 'I':
    No sequence available.

  • Chain 'J':
    No sequence available.

  • Chain 'K':
    No sequence available.

  • Chain 'L':
    No sequence available.

  • Chain 'M':
    No sequence available.

  • Chain 'N':
    No sequence available.

  • Chain 'O':
    No sequence available.

  • Chain 'P':
    No sequence available.