PDB entry 1guk

View 1guk on RCSB PDB site
Description: crystal structure of murine alpha-class gsta4-4
Class: transferase
Keywords: glutathione s-transferase, gst, crystal structure, oxidative stress, transferase
Deposited on 1997-12-11, released 1998-04-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.234
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase a4-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1guka1, d1guka2
  • Chain 'B':
    Compound: glutathione s-transferase a4-4
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gukb1, d1gukb2

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gukA (A:)
    maakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplvei
    dgmmltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekees
    ydlilsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpl
    lqafktrisniptikkflqpgsqrkpppdgpyvevvrivlkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gukA (A:)
    pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
    ltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekeesydli
    lsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqaf
    ktrisniptikkflqpgsqrkpppdgpyvevvriv
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gukB (B:)
    maakpklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplvei
    dgmmltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktpkekees
    ydlilsraktryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpl
    lqafktrisniptikkflqpgsqrkpppdgpyvevvrivlkf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gukB (B:)
    pklyyfngrgrmesirwllaaagvefeeefletreqyekmqkdghllfgqvplveidgmm
    ltqtrailsylaakynlygkdlkervridmyadgtqdlmmmiavapfktsydlilsrakt
    ryfpvfekilkdhgeaflvgnqlswadiqlleailmveelsapvlsdfpllqafktrisn
    iptikkflqpgsqrkpppdgpyvevvriv