PDB entry 1guj

View 1guj on RCSB PDB site
Description: insulin at ph 2: structural analysis of the conditions promoting insulin fibre formation.
Class: hormone
Keywords: hormone, metabolic role, low ph, sulphate ions
Deposited on 2002-01-28, released 2002-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.172
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.07: d1guj.1
• Chain 'B':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Domains in SCOPe 2.07: d1guj.1
• Chain 'C':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P01308 (0-End)
  Domains in SCOPe 2.07: d1guj.2
• Chain 'D':
  Compound: insulin
  Species: Homo sapiens [TaxId:9606]
  Domains in SCOPe 2.07: d1guj.2
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gujA (A:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gujB (B:)
  fvnqhlcgshlvealylvcgergffytpkt
  

  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gujC (C:)
  giveqcctsicslyqlenycn
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gujD (D:)
  fvnqhlcgshlvealylvcgergffytpkt