PDB entry 1guj
View 1guj on RCSB PDB site
Description: insulin at ph 2: structural analysis of the conditions promoting insulin fibre formation.
Class: hormone
Keywords: hormone, metabolic role, low ph, sulphate ions
Deposited on
2002-01-28, released
2002-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated
2009-02-24, with a file datestamp of
2009-03-01.
Experiment type: XRAY
Resolution: 1.62 Å
R-factor: 0.172
AEROSPACI score: 0.58
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1guj.1 - Chain 'B':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Domains in SCOPe 2.07: d1guj.1 - Chain 'C':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Database cross-references and differences (RAF-indexed):
Domains in SCOPe 2.07: d1guj.2 - Chain 'D':
Compound: insulin
Species: Homo sapiens [TaxId:9606]
Domains in SCOPe 2.07: d1guj.2 - Heterogens: SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>1gujA (A:)
giveqcctsicslyqlenycn
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>1gujB (B:)
fvnqhlcgshlvealylvcgergffytpkt
- Chain 'C':
Sequence; same for both SEQRES and ATOM records: (download)
>1gujC (C:)
giveqcctsicslyqlenycn
- Chain 'D':
Sequence; same for both SEQRES and ATOM records: (download)
>1gujD (D:)
fvnqhlcgshlvealylvcgergffytpkt