PDB entry 1gui

View 1gui on RCSB PDB site
Description: cbm4 structure and function
Class: carbohydrate binding module
Keywords: carbohydrate binding module, cbm, glucan, cellulose
Deposited on 2002-01-27, released 2002-09-26
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: laminarinase 16a
  Species: Thermotoga maritima [TaxId:2336]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q9WXN1 (0-154)
  Domains in SCOPe 2.01: d1guia_
• Heterogens: CA, GOL, BGC, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1guiA (A:)
  sinngtfdepivndqannpdewfiwqagdygisgarvsdygvrdgyayitiadpgtdtwh
  iqfnqwiglyrgktytisfkakadtprpinvkilqnhdpwtnyfaqtvnltadwqtftft
  ythpddadevvqisfelgegtattiyfddvtvspq