PDB entry 1guf

View 1guf on RCSB PDB site
Description: enoyl thioester reductase from candida tropicalis
Deposited on 2002-01-25, released 2003-03-13
The last revision prior to the SCOP 1.71 freeze date was dated 2003-11-07, with a file datestamp of 2003-11-07.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.178
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gufA (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gufB (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity