PDB entry 1guf

View 1guf on RCSB PDB site
Description: Enoyl thioester reductase from Candida tropicalis
Class: oxidoreductase
Keywords: oxidoreductase
Deposited on 2002-01-25, released 2003-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial
    Species: CANDIDA TROPICALIS [TaxId:5482]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gufa1, d1gufa2
  • Chain 'B':
    Compound: enoyl-[acyl-carrier-protein] reductase [nadph, b-specific] 1, mitochondrial
    Species: CANDIDA TROPICALIS [TaxId:5482]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gufb1, d1gufb2
  • Heterogens: GOL, SO4, NDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gufA (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gufB (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity