PDB entry 1gub

View 1gub on RCSB PDB site
Description: hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations
Class: sugar-binding protein
Keywords: sugar-binding protein, periplasmic binding protein, allose, x-ray crystallography, hinge bending, conformational change
Deposited on 2002-01-24, released 2003-03-06
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.284
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: d-allose-binding periplasmic protein
  Species: Escherichia coli [TaxId:83333]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P39265 (0-287)
  Domains in SCOPe 2.07: d1guba_
• Heterogens: NI, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1gubA (A:)
  aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
  kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
  gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
  ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
  mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq