PDB entry 1gub

View 1gub on RCSB PDB site
Description: hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations
Class: sugar-binding protein
Keywords: sugar-binding protein, periplasmic binding protein, allose, x-ray crystallography, hinge bending, conformational change
Deposited on 2002-01-24, released 2003-03-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.284
AEROSPACI score: 0.13 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: d-allose-binding periplasmic protein
    Species: Escherichia coli [TaxId:83333]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1guba_
  • Heterogens: NI, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gubA (A:)
    aaeyavvlktlsnpfwvdmkkgiedeaktlgvsvdifaspsegdfqsqlqlfedlsnkny
    kgiafaplssvnlvmpvarawkkgiylvnldekidmdnlkkaggnveafvttdnvavgak
    gasfiidklgaeggevaiiegkagnasgearrngateafkkasqiklvasqpadwdrika
    ldvatnvlqrnpnikaiycandtmamgvaqavanagktgkvlvvgtdgipearkmveagq
    mtatvaqnpadigatglklmvdaeksgkvipldkapefklvdsilvtq