PDB entry 1gu7

View 1gu7 on RCSB PDB site
Description: enoyl thioester reductase from candida tropicalis
Deposited on 2002-01-24, released 2003-03-13
The last revision prior to the SCOP 1.71 freeze date was dated 2003-10-02, with a file datestamp of 2003-10-02.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.174
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gu7A (A:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gu7B (B:)
    mitaqavlytqhgepkdvlftqsfeidddnlapnevivktlgspvnpsdinqiqgvypsk
    pakttgfgttepaapcgneglfevikvgsnvssleagdwvipshvnfgtwrthalgnddd
    fiklpnpaqskangkpngltinqgatisvnpltaylmlthyvkltpgkdwfiqnggtsav
    gkyasqigkllnfnsisvirdrpnldevvaslkelgatqvitedqnnsrefgptikewik
    qsggeaklalncvggksstgiarklnnnglmltyggmsfqpvtiptslyifknftsagfw
    vtellknnkelktstlnqiiawyeegkltdaksietlydgtkplhelyqdgvanskdgkq
    lity