PDB entry 1gu2

View 1gu2 on RCSB PDB site
Description:
Deposited on 2002-01-22, released 2003-01-16
The last revision prior to the SCOP 1.63 freeze date was dated 2003-01-16, with a file datestamp of 2003-01-16.
Experiment type: XRAY
Resolution: 1.19 Å
R-factor: 0.1483
AEROSPACI score: 0.85 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gu2a_
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1gu2b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gu2A (A:)
    dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
    gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
    kptk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gu2B (B:)
    dvtnaeklvykytniahsanpmyeapsitdgkiffnrkfktpsgkeaacaschtnnpanv
    gknivtgkeipplaprvntkrftdidkvedeftkhcndilgadcspsekanfiaylltet
    kpt