PDB entry 1gtv

View 1gtv on RCSB PDB site
Description: crystal structure of mycobacterium tuberculosis thymidylate kinase complexed with thymidine-5'-diphosphate (tdp)
Class: transferase
Keywords: transferase, transferase (ATP:tmp phosphotransferase), kinase
Deposited on 2002-01-21, released 2002-03-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-11-21, with a file datestamp of 2018-11-16.
Experiment type: XRAY
Resolution: 1.55 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thymidylate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gtva_
  • Chain 'B':
    Compound: thymidylate kinase
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1gtvb_
  • Heterogens: MG, TYD, SO4, ACT, TMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gtvA (A:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatlappdvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtvA (A:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gtvB (B:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatlappdvps
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtvB (B:)
    mliaiegvdgagkrtlveklsgafraagrsvatlafprygqsvaadiaaealhgehgdla
    ssvyamatlfaldragavhtiqglcrgydvvildryvasnaaysaarlhenaagkaaawv
    qriefarlglpkpdwqvllavsaelagersrgraqrdpgrardnyerdaelqqrtgavya
    elaaqgwggrwlvvgadvdpgrlaatla