PDB entry 1gtu

View 1gtu on RCSB PDB site
Description: ligand-free human glutathione s-transferase m1a-1a
Deposited on 1998-06-11, released 1999-02-02
The last revision prior to the SCOP 1.55 freeze date was dated 1999-02-02, with a file datestamp of 1999-02-02.
Experiment type: XRAY
Resolution: 2.68 Å
R-factor: 0.211
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtuA (A:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtuB (B:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtuC (C:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtuD (D:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk