PDB entry 1gtm

View 1gtm on RCSB PDB site
Description: structure of glutamate dehydrogenase
Class: oxidoreductase
Keywords: oxidoreductase, nad, nadp
Deposited on 1996-08-22, released 1997-01-11
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-02-22, with a file datestamp of 2012-02-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.174
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutamate dehydrogenase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80319 (Start-418)
      • conflict (2)
    Domains in SCOPe 2.06: d1gtma1, d1gtma2
  • Chain 'B':
    Compound: glutamate dehydrogenase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80319 (Start-418)
      • conflict (2)
    Domains in SCOPe 2.06: d1gtmb1, d1gtmb2
  • Chain 'C':
    Compound: glutamate dehydrogenase
    Species: Pyrococcus furiosus [TaxId:186497]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P80319 (Start-418)
      • conflict (2)
    Domains in SCOPe 2.06: d1gtmc1, d1gtmc2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gtmA (A:)
    veadpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqh
    nwargptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdreke
    rlargyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
    ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
    avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
    itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
    gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtmA (A:)
    adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
    argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
    argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsigg
    slgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvvav
    sdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieevit
    kknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnitgy
    ywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gtmB (B:)
    veadpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqh
    nwargptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdreke
    rlargyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
    ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
    avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
    itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
    gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtmB (B:)
    adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
    argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
    argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsigg
    slgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvvav
    sdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieevit
    kknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnitgy
    ywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gtmC (C:)
    veadpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqh
    nwargptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdreke
    rlargyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsi
    ggslgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvv
    avsdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieev
    itkknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnit
    gyywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtmC (C:)
    adpyeivikqleraaqymeiseealeflkrpqrivevtipvemddgsvkvftgfrvqhnw
    argptkggirwhpeetlstvkalaawmtwktavmdlpygggkggiivdpkklsdrekerl
    argyiraiydvispyedipapdvytnpqimawmmdeyetisrrktpafgiitgkplsigg
    slgrieatargasytireaakvlgwdtlkgktiaiqgygnagyylakimsedfgmkvvav
    sdskggiynpdglnadevlkwknehgsvkdfpgatnitneellelevdvlapaaieevit
    kknadnikakivaevangpvtpeadeilfekgilqipdflcnaggvtvsyfewvqnitgy
    ywtieevrerldkkmtkafydvyniakeknihmrdaayvvavqrvyqamldrgwvkh