PDB entry 1gtf

View 1gtf on RCSB PDB site
Description: the structure of the trp RNA-binding attenuation protein (trap) bound to a 53-nucleotide RNA molecule containing gaguu repeats
Class: RNA binding protein/RNA
Keywords: RNA binding protein-RNA complex, transcription attenuation, RNA-binding protein, trp RNA
Deposited on 2002-01-15, released 2002-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-31.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.194
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfa_
  • Chain 'B':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfb_
  • Chain 'C':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfc_
  • Chain 'D':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfd_
  • Chain 'E':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfe_
  • Chain 'F':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtff_
  • Chain 'G':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfg_
  • Chain 'H':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfh_
  • Chain 'I':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfi_
  • Chain 'J':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfj_
  • Chain 'K':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfk_
  • Chain 'L':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfl_
  • Chain 'M':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfm_
  • Chain 'N':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfn_
  • Chain 'O':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfo_
  • Chain 'P':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfp_
  • Chain 'Q':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfq_
  • Chain 'R':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfr_
  • Chain 'S':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfs_
  • Chain 'T':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtft_
  • Chain 'U':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfu_
  • Chain 'V':
    Compound: trp RNA-binding attenuation protein (trap)
    Species: BACILLUS STEAROTHERMOPHILUS [TaxId:1422]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gtfv_
  • Chain 'W':
    Compound: (gaguu)10gag 53-nucleotide RNA
    Species: synthetic, synthetic
  • Heterogens: TRP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gtfA (A:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfA (A:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gtfB (B:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfB (B:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gtfC (C:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfC (C:)
    nsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqt
    rhgviesegk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gtfD (D:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfD (D:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1gtfE (E:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfE (E:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1gtfF (F:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfF (F:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1gtfG (G:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfG (G:)
    nsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqt
    rhgviesegk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1gtfH (H:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfH (H:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgvieseg
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1gtfI (I:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfI (I:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1gtfJ (J:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfJ (J:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviese
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >1gtfK (K:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfK (K:)
    sdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiqtr
    hgviesegk
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >1gtfL (L:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfL (L:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1gtfM (M:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfM (M:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgviesegk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1gtfN (N:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfN (N:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1gtfO (O:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfO (O:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1gtfP (P:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfP (P:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >1gtfQ (Q:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfQ (Q:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >1gtfR (R:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfR (R:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1gtfS (S:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfS (S:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1gtfT (T:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfT (T:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1gtfU (U:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfU (U:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1gtfV (V:)
    mytnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkay
    iqtrhgviesegkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gtfV (V:)
    tnsdfvvikaledgvnvigltrgadtrfhhsekldkgevliaqftehtsaikvrgkayiq
    trhgvieseg
    

  • Chain 'W':
    No sequence available.