PDB entry 1gtb

View 1gtb on RCSB PDB site
Description: crystal structures of a schistosomal drug and vaccine target: glutathione s-transferase from schistosoma japonica and its complex with the leading antischistosomal drug praziquantel
Class: glutathione transferase
Keywords: glutathione transferase
Deposited on 1994-12-01, released 1995-12-01
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.212
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Schistosoma japonicum [TaxId:6182]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d1gtba1, d1gtba2
  • Heterogens: PZQ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gtbA (A:)
    mspilgywkikglvqptrllleyleekyeehlyerdegdkwrnkkfelglefpnlpyyid
    gdvkltqsmaiiryiadkhnmlggcpkeraeismlegavldirygvsriayskdfetlkv
    dflsklpemlkmfedrlchktylngdhvthpdfmlydaldvvlymdpmcldafpklvcfk
    krieaipqidkylksskyiawplqgwqatfgggdhppk