PDB entry 1gt8

View 1gt8 on RCSB PDB site
Description: dihydropyrimidine dehydrogenase (dpd) from pig, ternary complex with nadph and uracil-4-acetic acid
Deposited on 2002-01-14, released 2002-04-11
The last revision prior to the SCOP 1.61 freeze date was dated 2002-04-11, with a file datestamp of 2002-04-11.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.214
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gt8A (A:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltpnvtdivsia
    raakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravtti
    aralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylk
    sieelqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqn
    aafpplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcym
    tcndsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gt8A (A:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscphgmgemglacgqdpelvrnicrwvrqavqipffakltpnvtdivsiara
    akeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravttiar
    alpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylksi
    eelqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaa
    fpplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtc
    ndsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gt8B (B:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltpnvtdivsia
    raakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravtti
    aralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylk
    sieelqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqn
    aafpplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcym
    tcndsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gt8B (B:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscphgmgmglacgqdpelvrnicrwvrqavqipffakltpnvtdivsiaraa
    keggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravttiara
    lpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylksie
    elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqlerk
    pfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgyqa
    iqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gt8C (C:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltpnvtdivsia
    raakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravtti
    aralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylk
    sieelqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqn
    aafpplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcym
    tcndsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gt8C (C:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscplacgqdpelvrnicrwvrqavqipffakltpnvtdivsiaraakeggad
    gvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravttiaralpgfpi
    latggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylksieelqgwd
    gqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnaafpplerk
    pfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgyqa
    iqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1gt8D (D:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscphgmgergmglacgqdpelvrnicrwvrqavqipffakltpnvtdivsia
    raakeggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravtti
    aralpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylk
    sieelqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqn
    aafpplerkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcym
    tcndsgyqaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gt8D (D:)
    apvlskdvadiesilalnprtqshaalhstlakkldkkhwkrnpdkncfhceklennfdd
    ikhttlgergalreamrclkcadapcqkscpthldiksfitsisnknyygaakmifsdnp
    lgltcgmvcptsdlcvggcnlyateegsinigglqqfasevfkamnipqirnpclpsqek
    mpeaysakiallgagpasiscasflarlgysditifekqeyvgglstseipqfrlpydvv
    nfeielmkdlgvkiicgkslseneitlntlkeegykaafigiglpepktddifqgltqdq
    gfytskdflplvaksskagmcachsplpsirgavivlgagdtafdcatsalrcgarrvfl
    vfrkgfvniravpeevelakeekceflpflsprkvivkggrivavqfvrteqdetgkwne
    dedqivhlkadvvisafgsvlrdpkvkealspikfnrwdlpevdpetmqtsepwvfaggd
    ivgmanttvesvndgkqaswyihkyiqaqygasvsakpelplfytpvdlvdisvemaglk
    finpfglasaapttsssmirrafeagwgfaltktfsldkdivtnvsprivrgttsgpmyg
    pgqssflnielisektaaywcqsvtelkadfpdniviasimcsynkndwmelsrkaeasg
    adalelnlscphgmgmglacgqdpelvrnicrwvrqavqipffakltpnvtdivsiaraa
    keggadgvtatntvsglmglkadgtpwpavgagkrttyggvsgtairpialravttiara
    lpgfpilatggidsaesglqflhsgasvlqvcsavqnqdftviqdyctglkallylksie
    elqgwdgqspgteshqkgkpvpriaelmgkklpnfgpyleqrkkiiaeekmrlkeqnple
    rkpfipkkpipaikdvigkalqylgtfgelsnieqvvavideemcincgkcymtcndsgy
    qaiqfdpethlptvtdtctgctlclsvcpiidcirmvsrttpyepkrglpla