PDB entry 1gt7

View 1gt7 on RCSB PDB site
Description: L-rhamnulose-1-phosphate aldolase from Escherichia coli
Class: lyase
Keywords: lyase, aldolase (lyase), class II, zinc enzyme, bacterial l- rhamnose metabolism, cleavage of l-rhamnulose-1-phosphate to dihydroxyacetonephosphate and l-lactaldehyde
Deposited on 2002-01-14, released 2002-05-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-11-20, with a file datestamp of 2013-11-15.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.233
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7a_
  • Chain 'B':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7b_
  • Chain 'C':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7c_
  • Chain 'D':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7d_
  • Chain 'E':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7e_
  • Chain 'F':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7f_
  • Chain 'G':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7g_
  • Chain 'H':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7h_
  • Chain 'I':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7i_
  • Chain 'J':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7j_
  • Chain 'K':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7k_
  • Chain 'L':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7l_
  • Chain 'M':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7m_
  • Chain 'N':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7n_
  • Chain 'O':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7o_
  • Chain 'P':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7p_
  • Chain 'Q':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7q_
  • Chain 'R':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7r_
  • Chain 'S':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7s_
  • Chain 'T':
    Compound: rhamnulose-1-phosphate aldolase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt7t_
  • Heterogens: ZN, PGH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7A (A:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7B (B:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7C (C:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7D (D:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7E (E:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7F (F:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7G (G:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7H (H:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'I':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7I (I:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7J (J:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'K':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7K (K:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7L (L:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'M':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7M (M:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7N (N:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7O (O:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7P (P:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7Q (Q:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7R (R:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'S':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7S (S:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal
    

  • Chain 'T':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt7T (T:)
    mqnitqswfvqgmikattdawlkgwdernggnltlrlddadiapyhdnfhqqpryiplsq
    pmpllantpfivtgsgkffrnvqldpaanlgivkvdsdgagyhilwgltneavptselpa
    hflshcerikatngkdrvimhchatnlialtyvlendtavftrqlwegsteclvvfpdgv
    gilpwmvpgtdeigqataqemqkhslvlwpfhgvfgsgptldetfglidtaeksaqvlvk
    vysmggmkqtisreelialgkrfgvtplasalal