PDB entry 1gt0

View 1gt0 on RCSB PDB site
Description: Crystal structure of a POU/HMG/DNA ternary complex
Class: transcription
Keywords: transcription factor, pou factors, sox proteins, transcription
Deposited on 2002-01-09, released 2003-01-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2012-11-14, with a file datestamp of 2012-11-09.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.232
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5'-d(*tp*tp*cp*tp*tp*tp*gp*tp*tp*tp* gp*gp*ap* tp*gp*cp*tp*ap*ap*tp*gp*gp*gp*a)-3'
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Chain 'B':
    Compound: 5'-d(*ap*tp*cp*cp*cp*ap*tp*tp*ap*gp* cp*ap*tp*cp*cp*ap*ap*ap*cp*ap*ap*ap*gp*a)-3'
    Species: MUS MUSCULUS, synthetic [TaxId:10090]
  • Chain 'C':
    Compound: octamer-binding transcription factor 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14859
      • engineered mutation (60)
      • engineered mutation (148)
    Domains in SCOPe 2.07: d1gt0c1, d1gt0c2
  • Chain 'D':
    Compound: transcription factor sox-2
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1gt0d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1gt0C (C:)
    eepsdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknm
    sklkpllekwlndaenlssdsslsspsalnspgieglsrrrkkrtsietnirvaleksfl
    enqkptseeitmiadqlnmekevirvwfsnrrqkekrin
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gt0C (C:)
    psdleeleqfaktfkqrriklgftqgdvglamgklygndfsqttisrfealnlsfknmsk
    lkpllekwlndaenlglsrrrkkrtsietnirvaleksflenqkptseeitmiadqlnme
    kevirvwfsnrrqkekri
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gt0D (D:)
    drvkrpmnafmvwsrgqrrkmaqenpkmhnseiskrlgaewkllsetekrpfideakrlr
    alhmkehpdykyrprrktkt