PDB entry 1gsx

View 1gsx on RCSB PDB site
Description: crystal structure of the p65 crystal form of photoactive yellow protein g47s/g51s mutant
Deposited on 2002-01-09, released 2002-02-14
The last revision prior to the SCOP 1.59 freeze date was dated 2002-02-14, with a file datestamp of 2002-02-14.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.197
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.59: d1gsxa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gsxA (A:)
    vafgsedientlakmddgqldglafgaiqldgdgnilqynaaesditsrdpkqvigknff
    kdvapctdspefygkfkegvasgnlntmfeytfdyqmtptkvkvhmkkalsgdsywvfvk
    rv