PDB entry 1gsu

View 1gsu on RCSB PDB site
Description: an avian class-mu glutathione s-transferase, cgstm1-1 at 1.94 angstrom resolution
Class: detoxification enzyme
Keywords: detoxification enzyme, glutathione s-transferase, s-hexyl glutathione
Deposited on 1997-09-02, released 1998-03-04
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.21
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: class-mu glutathione s-transferase
    Species: Gallus gallus [TaxId:9031]
    Gene: CGSTM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gsua1, d1gsua2
  • Chain 'B':
    Compound: class-mu glutathione s-transferase
    Species: Gallus gallus [TaxId:9031]
    Gene: CGSTM1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gsub1, d1gsub2
  • Heterogens: GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1gsuA (A:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpayleqlpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gsuA (A:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpayleqlpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1gsuB (B:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpayleqlpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnkke
    

    Sequence, based on observed residues (ATOM records): (download)
    >1gsuB (B:)
    vvtlgywdirglahairllleytetpyqerrykagpapdfdpsdwtnekeklgldfpnlp
    ylidgdvkltqsnailryiarkhnmcgetevekqrvdvlenhlmdlrmafarlcyspdfe
    klkpayleqlpgklrqlsrflgsrswfvgdkltfvdflaydvldqqrmfvpdcpelqgnl
    sqflqrfealekisaymrsgrfmkapifwytalwnnk