PDB entry 1gsp

View 1gsp on RCSB PDB site
Description: ribonuclease t1 complexed with 2',3'-cgps, 1 day
Class: endoribonuclease
Keywords: hydrolase, endoribonuclease
Deposited on 1997-11-28, released 1998-02-25
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.151
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ribonuclease t1
    Species: Aspergillus oryzae [TaxId:5062]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1gspa_
  • Heterogens: CA, SGP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1gspA (A:)
    acdytcgsncysssdvstaqaagyklhedgetvgsnsyphkynnyegfdfsvsspyyewp
    ilssgdvysggspgadrvvfnennqlagvithtgasgnnfvect